Proteintech, 25065-1-AP, PRELID3A Polyclonal antibody

Size: 20ul / 150ul The PRELID3A (25065-1-AP) by Proteintech is a Polyclonal antibody targeting PRELID3A in WB, ELISA applications with reactivity to human, mouse, rat samples 25065-1-AP targets PRELID3A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16861 Product name: Recombinant human SLMO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 61-124 aa of BC106750 Sequence: LPSLVRAILGTSRTLTYIREHSVVDPVEKKMELCSTNITLTNLVSVNERLVYTPHPENPEMTVL Predict reactive species Full Name: slowmo homolog 1 (Drosophila) Calculated Molecular Weight: 172 aa, 19 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC106750 Gene Symbol: PRELID3A Gene ID (NCBI): 10650 RRID: AB_3085768 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96N28 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.