Proteintech, 25078-1-AP, TMEM134 Polyclonal antibody

Size: 20ul / 150ul The TMEM134 (25078-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM134 in WB, IF/ICC, ELISA applications with reactivity to human, rat samples 25078-1-AP targets TMEM134 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat spleen tissue, mouse spleen tissue Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Transmembrane protein 134 is a protein encoded by the TMEM134 gene. TMEM134 is regulated by the promoter GXP50275. TMEM134 is ubiquitously expressed in the majority of human tissues. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18533 Product name: Recombinant human TMEM134 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-124 aa of BC125134 Sequence: QFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVV Predict reactive species Full Name: transmembrane protein 134 Calculated Molecular Weight: 180 aa, 20 kDa Observed Molecular Weight: 22-27 kDa GenBank Accession Number: BC125134 Gene Symbol: TMEM134 Gene ID (NCBI): 80194 RRID: AB_3669461 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H6X4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.