Proteintech, 25094-1-AP, ZNF277 Polyclonal antibody

Size: 20ul / 150ul The ZNF277 (25094-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF277 in WB, IF/ICC, ELISA applications with reactivity to human samples 25094-1-AP targets ZNF277 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, Jurkat cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18979 Product name: Recombinant human ZNF277 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-278 aa of BC020626 Sequence: MQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTTTLEGSPSVPCIFCEEHFPVAEQDKLLKHMIIEHKIVIADVKLVADFQRYILYWRKRFTEQPITDFCSVIRINSTAPFEEQENYFLLCDVLPEDRILREELQKQRLREILEQQQQERNDTNFHGVCMFCNEEFLGNRSVILNHMAREHAFNIGLPDNIVNCNEFLCTLQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRKINPKNREYDRFYVINYLVRLSFHNLKFDCSTANKIFLRTN Predict reactive species Full Name: zinc finger protein 277 Calculated Molecular Weight: 450 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC020626 Gene Symbol: ZNF277 Gene ID (NCBI): 11179 RRID: AB_2879893 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRM2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.