Iright
BRAND / VENDOR: Proteintech

Proteintech, 25102-1-AP, NMES1 Polyclonal antibody

CATALOG NUMBER: 25102-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NMES1 (25102-1-AP) by Proteintech is a Polyclonal antibody targeting NMES1 in WB, ELISA applications with reactivity to human, mouse samples 25102-1-AP targets NMES1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human testis tissue, mouse colon tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Nmes1, encoding for Normal Mucosa of Esophagus-Specific gene 1, also known as C15orf48, Modulator of Cytochrome C Oxidase during Inflammation [MOCCI]), was first identified in a study of human esophageal squamous cell carcinoma (ESCC) tissues (PMID: 30013631). Nmes1 is expressed in epithelial tissue and is believed to be a tumor suppressor gene. Nmes1 encodes for a small protein consisting of 83 amino acid and is a nuclear protein (PMID: 37971166). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18744 Product name: Recombinant human C15orf48 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-83 aa of BC021173 Sequence: FFQLLMKRKELIPLVVFMTVAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQNVQRVTK Predict reactive species Full Name: chromosome 15 open reading frame 48 Calculated Molecular Weight: 83 aa, 9 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC021173 Gene Symbol: C15orf48 Gene ID (NCBI): 84419 RRID: AB_3669463 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9C002 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924