Iright
BRAND / VENDOR: Proteintech

Proteintech, 25110-1-AP, BTNL2 Polyclonal antibody

CATALOG NUMBER: 25110-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BTNL2 (25110-1-AP) by Proteintech is a Polyclonal antibody targeting BTNL2 in WB, ELISA applications with reactivity to human, mouse samples 25110-1-AP targets BTNL2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HL-60 cells, mouse kidney tissue, HepG2 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Butyrophilin-like protein 2 (BTNL2) is a transmembrane immunoregulatory protein that is highly expressed in the gastrointestinal tract. BTNL2 belongs to the butyrophilin-like family of proteins, and several of the butyrophilins and butyrophilin-like proteins, such as BTN2A1, BTN3A1, skint-1, BTNL1 and BTNL6, have been shown to play an essential role in regulating γδ T cell development and differentiation. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18803 Product name: Recombinant human BTNL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-229 aa of BC127642 Sequence: KQSEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVGLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISI Predict reactive species Full Name: butyrophilin-like 2 (MHC class II associated) Calculated Molecular Weight: 455 aa, 50 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC127642 Gene Symbol: BTNL2 Gene ID (NCBI): 56244 RRID: AB_2879902 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UIR0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924