Proteintech, 25117-1-AP, SHOX Polyclonal antibody

Size: 20ul / 150ul The SHOX (25117-1-AP) by Proteintech is a Polyclonal antibody targeting SHOX in WB, ELISA applications with reactivity to human, mouse samples 25117-1-AP targets SHOX in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Short stature homeobox protein (SHOX), also named as GCFX, is a 292 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the paired homeobox family. SHOX. SHOX controls fundamental aspects of growth and development. SHOX undergoes splicing resulting in two isoforms, SHOXA and SHOXB. SHOXA is a 32 kDa protein and is expressed in skeletal muscle, placental, pancreas, heart and bone marrow fibroblast and, to a lesser extent, in kidney and lung. SHOXB is 25 kDa protein and is highly expressed in osteogenic cells, but not expressed in brain, kidney, liver or lung. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18930 Product name: Recombinant human SHOX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-110 aa of BC148783 Sequence: KDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDITEGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDED Predict reactive species Full Name: short stature homeobox Calculated Molecular Weight: 292 aa, 32 kDa Observed Molecular Weight: 25-32 kDa GenBank Accession Number: BC148783 Gene Symbol: SHOX Gene ID (NCBI): 6473 RRID: AB_2879905 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15266 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.