Proteintech, 25133-1-AP, HAP1 Polyclonal antibody

Size: 20ul / 150ul The HAP1 (25133-1-AP) by Proteintech is a Polyclonal antibody targeting HAP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 25133-1-AP targets HAP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: fetal human brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information HAP1 (Huntingtin-associated protein 1) was originally identified as neuronal protein that specifically associates with HTT/huntingtin and the binding is enhanced by an expanded polyglutamine repeat within HTT. HTT is expressed ubiquitously, while HAP1 is expressed predominantly in the central nervous system (CNS). Both HTT and HAP1 participate in intracellular trafficking. HAP1 is involved in the vesicular transport, gene transcription regulation, membrane receptor trafficking and other functions such as calcium release and protein aggregation (PMID: 19262167). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17705 Product name: Recombinant human HAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 331-671 aa of BC156728 Sequence: LREEASQLDTLEDEEQMLILECVEQFSEASQQMAELSEVLVLRLENYERQQQEVARLQAQVLKLQQRCRMYGAETEKLQKQLASEKEIQMQLQEESVWVGSQLQDLREKYMDCGGMLIEMQEEVKTLRQQPPVSTGSATHYPYSVPLETLPGFQETLAEELRTSLRRMISDPVYFMERNYEMPRGDTSSLRYDFRYSEDREQVRGFEAEEGLMLAADIMRGEDFTPAEEFVPQEELGAAKKVPAEEGVMEEAELVSEETEGWEEVELELDEATRMNVVTSALEASGLGPSHLDMNYVLQQLANWQDAHYRRQLRWKMLQKGECPHGALPAASRTSCRSSCR Predict reactive species Full Name: huntingtin-associated protein 1 Calculated Molecular Weight: 671 aa, 76 kDa Observed Molecular Weight: 75-80 kDa GenBank Accession Number: BC156728 Gene Symbol: HAP1 Gene ID (NCBI): 9001 RRID: AB_2879915 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P54257 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.