Proteintech, 25137-1-AP, ONECUT1 Polyclonal antibody

Size: 20ul / 150ul The ONECUT1 (25137-1-AP) by Proteintech is a Polyclonal antibody targeting ONECUT1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25137-1-AP targets ONECUT1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ONECUT1, also named as Hepatocyte nuclear factor 6 (HNF6), is a 465 amino acid protein, which contains one CUT DNA-binding domain and one homeobox DNA-binding domain. ONECUT1 localizes in the nucleus and belongs to the CUT homeobox family. ONECUT1 as a transcription activator is involved in the some liver genes transcription. ONECUT1 is highly expressed in liver and lower in testis, skin. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18250 Product name: Recombinant human ONECUT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 167-292 aa of BC140830 Sequence: PYHKDVAGMGQSLSPLSSSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAGMVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEI Predict reactive species Full Name: one cut homeobox 1 Calculated Molecular Weight: 465 aa, 51 kDa Observed Molecular Weight: 51-55 kDa GenBank Accession Number: BC140830 Gene Symbol: ONECUT1 Gene ID (NCBI): 3175 RRID: AB_2879918 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBC0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.