Iright
BRAND / VENDOR: Proteintech

Proteintech, 25142-1-AP, HNRNPA3 Polyclonal antibody

CATALOG NUMBER: 25142-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HNRNPA3 (25142-1-AP) by Proteintech is a Polyclonal antibody targeting HNRNPA3 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 25142-1-AP targets HNRNPA3 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, Jurkat cells Positive IHC detected in: human stomach tissue, human colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse colon tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information HNRNPA3 also named as hnRNP A3 or heterogeneous nuclear ribonucleoprotein A3 is a 378 amino acid protein, which contains 2 RRM domains and localizes in nucleus. HNRNPA3 is a component of the spliceosome C complex and play a role in cytoplasmic trafficking of RNA. Binds to the cis-acting response element. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, pig, monkey, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18248 Product name: Recombinant human HNRNPA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 207-330 aa of BC113470 Sequence: MQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYN Predict reactive species Full Name: heterogeneous nuclear ribonucleoprotein A3 Calculated Molecular Weight: 378 aa, 40 kDa Observed Molecular Weight: 37-40 kDa GenBank Accession Number: BC113470 Gene Symbol: HNRNPA3 Gene ID (NCBI): 220988 RRID: AB_2879921 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51991 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924