Iright
BRAND / VENDOR: Proteintech

Proteintech, 25146-1-AP, Cathepsin E Polyclonal antibody

CATALOG NUMBER: 25146-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Cathepsin E (25146-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin E in WB, ELISA applications with reactivity to human, mouse, rat samples 25146-1-AP targets Cathepsin E in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Calu-3 cells, mouse stomach tissue, rat stomach tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Cathepsin E (CTSE) is an aspartic protease and a member of the peptidase A1 family of proteases, along with pepsin A and cathepsin D (CTSD) (PMID: 31582345). Caathepsin E is essential for degradation of these lysosomal membrane proteins, and that its deficiency is implicated in the development of a new form of lysosomal storage disorder associated with the elevation of lysosomal pH (PMID: 17095504). It associates with lysosomal and endosomal pathways participating actively in immune response regulation. Cathepsin E specifically induces growth arrest and apoptosis in human prostate cancer cell lines (PMID: 20482316). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18484 Product name: Recombinant human CTSE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 108-275 aa of BC042537 Sequence: YCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEG Predict reactive species Full Name: cathepsin E Calculated Molecular Weight: 396 aa, 43 kDa Observed Molecular Weight: 43-48 kDa GenBank Accession Number: BC042537 Gene Symbol: CTSE Gene ID (NCBI): 1510 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14091 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924