Proteintech, 25150-1-AP, LIN7A Polyclonal antibody

Size: 20ul / 150ul The LIN7A (25150-1-AP) by Proteintech is a Polyclonal antibody targeting LIN7A in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 25150-1-AP targets LIN7A in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18440 Product name: Recombinant human LIN7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC118609 Sequence: MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATA Predict reactive species Full Name: lin-7 homolog A (C. elegans) Calculated Molecular Weight: 233 aa, 26 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC118609 Gene Symbol: LIN7A Gene ID (NCBI): 8825 RRID: AB_2879925 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14910 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.