Proteintech, 25154-1-AP, PROSC Polyclonal antibody

Size: 20ul / 150ul The PROSC (25154-1-AP) by Proteintech is a Polyclonal antibody targeting PROSC in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 25154-1-AP targets PROSC in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells Positive IHC detected in: human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Human Pyridoxal 5′-phosphate-binding protein (PLPBP; previously proline synthase cotranscribed homolog, PROSC) was first described in 1999 and was demonstrated to be ubiquitously expressed in many tissues. PROSC is ubiquitously expressed in human tissues and is highly conserved throughout evolution. PROSC deficiency could therefore markedly increase free cellular PLP levels (PMID: 31825581, 27912044). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18369 Product name: Recombinant human PROSC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-275 aa of BC012334 Sequence: MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYVQELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSVKLADKVNSSWQRKGSPERLKVMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMTIGSFGHDLSQGPNPDFQLLLSLREELCKKLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTPDKCAADVKAPLEVAQEH Predict reactive species Full Name: proline synthetase co-transcribed homolog (bacterial) Calculated Molecular Weight: 275 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC012334 Gene Symbol: PROSC Gene ID (NCBI): 11212 RRID: AB_2879929 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94903 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.