Proteintech, 25178-1-AP, ZNF497 Polyclonal antibody

Size: 20ul / 150ul The ZNF497 (25178-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF497 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25178-1-AP targets ZNF497 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: human kidney tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18114 Product name: Recombinant human ZNF497 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC118983 Sequence: MESPRGWTLQVAPEEGQVLCNVKTATRGLSEGAVSGGWGAWENSTEVPREAGDGQRQQATLGAADEQGGPGRELGPADGGRDGAGPRSEPADRALRPSPLPEEPGCRCGECGK Predict reactive species Full Name: zinc finger protein 497 Calculated Molecular Weight: 498 aa, 55 kDa Observed Molecular Weight: 61-65 kDa GenBank Accession Number: BC118983 Gene Symbol: ZNF497 Gene ID (NCBI): 162968 RRID: AB_2879944 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZNH5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.