Iright
BRAND / VENDOR: Proteintech

Proteintech, 25184-1-AP, C8B Polyclonal antibody

CATALOG NUMBER: 25184-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C8B (25184-1-AP) by Proteintech is a Polyclonal antibody targeting C8B in WB, IHC, ELISA applications with reactivity to human samples 25184-1-AP targets C8B in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information The beta chain of complement component 8 (C8B) is one of three different subunits (alpha, beta, and gamma) of the complement component 8 (C8), which is a component of the MAC (membrane attack complex). The deficiency of C8B leads to the type II of C8 deficiency, leading to the malfunction of MAC. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18388 Product name: Recombinant human C8B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 242-591 aa of BC130575 Sequence: RNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS Predict reactive species Full Name: complement component 8, beta polypeptide Calculated Molecular Weight: 591 aa, 67 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC130575 Gene Symbol: C8B Gene ID (NCBI): 732 RRID: AB_3085774 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07358 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924