Proteintech, 25187-1-AP, CDC14B Polyclonal antibody

Size: 20ul / 150ul The CDC14B (25187-1-AP) by Proteintech is a Polyclonal antibody targeting CDC14B in WB, ELISA applications with reactivity to human samples 25187-1-AP targets CDC14B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SMMC-7721 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18227 Product name: Recombinant human CDC14B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 349-498 aa of BC156666 Sequence: PGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSASRKSSVKSLSISRTKTVLR Predict reactive species Full Name: CDC14 cell division cycle 14 homolog B (S. cerevisiae) Calculated Molecular Weight: 498 aa, 57 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC156666 Gene Symbol: CDC14B Gene ID (NCBI): 8555 RRID: AB_2879949 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60729 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.