Iright
BRAND / VENDOR: Proteintech

Proteintech, 25190-1-AP, RSL24D1 Polyclonal antibody

CATALOG NUMBER: 25190-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RSL24D1 (25190-1-AP) by Proteintech is a Polyclonal antibody targeting RSL24D1 in WB, IF/ICC, ELISA applications with reactivity to human samples 25190-1-AP targets RSL24D1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HL-60 cells, PC-3 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RSL24D1 (Ribosomal L24 Domain Containing 1) is a ribosomal protein that is primarily localized in the nucleolus and is involved in the biogenesis of the 60S ribosomal subunit. In mouse embryonic stem cells (ESCs), the expression level of RSL24D1 is high and significantly decreases during cell differentiation. The role of RSL24D1 in ribosome biogenesis includes facilitating proper protein docking in nucleolar and cytoplasmic precursor particles. After the completion of biogenesis, RSL24D1 dissociates from the particles and is thought to be replaced by ribosomal protein L24. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18195 Product name: Recombinant human RSL24D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC008409 Sequence: MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDVDMEDAP Predict reactive species Full Name: ribosomal L24 domain containing 1 Calculated Molecular Weight: 163 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC008409 Gene Symbol: RSL24D1 Gene ID (NCBI): 51187 RRID: AB_2879950 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHA3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924