Iright
BRAND / VENDOR: Proteintech

Proteintech, 25200-1-AP, ZIM3 Polyclonal antibody

CATALOG NUMBER: 25200-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZIM3 (25200-1-AP) by Proteintech is a Polyclonal antibody targeting ZIM3 in WB, ELISA applications with reactivity to human samples 25200-1-AP targets ZIM3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information ZIM3 (Zinc Finger Imprinted 3), also known as ZNF657 or ZNF264, is a protein containing zinc finger and KRAB domains. It belongs to the Krüppel C2H2-type zinc finger protein family and comprises 11 C2H2-type zinc fingers and 1 KRAB domain. ZIM3 influences chromatin organization by binding to the KAP1 protein, thereby regulating gene transcription. ZIM3 is predicted to have DNA-binding transcription factor activity and is involved in the transcriptional regulation of RNA polymerase II. Additionally, ZIM3 plays a core regulatory role in human major zygotic genome activation (ZGA). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18411 Product name: Recombinant human ZIM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 56-327 aa of BC114503 Sequence: DVILRLEQGKEPWLEEEEVLGSGRAEKNGDIGGQIWKPKDVKESLAREVPSINKETLTTQKGVECDGSKKILPLGIDDVSSLQHYVQNNSHDDNGYRKLVGNNPSKFVGQQLKCNACRKLFSSKSRLQSHLRRHACQKPFECHSCGRAFGEKWKLDKHQKTHAEERPYKCENCGNAYKQKSNLFQHQKMHTKEKPYQCKTCGKAFSWKSSCINHEKIHNAKKSYQCNECEKSFRQNSTLIQHKKVHTGQKPFQCTDCGKAFIYKSDLVKHQR Predict reactive species Full Name: zinc finger, imprinted 3 Calculated Molecular Weight: 472 aa, 57 kDa Observed Molecular Weight: 55-65 kDa GenBank Accession Number: BC114503 Gene Symbol: ZIM3 Gene ID (NCBI): 114026 RRID: AB_2879955 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PE6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924