Iright
BRAND / VENDOR: Proteintech

Proteintech, 25221-1-AP, BTN3A1 Polyclonal antibody

CATALOG NUMBER: 25221-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BTN3A1 (25221-1-AP) by Proteintech is a Polyclonal antibody targeting BTN3A1 in WB, IF/ICC, ELISA applications with reactivity to human samples 25221-1-AP targets BTN3A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-937 cells, Jurkat cells Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information BTN3A1, also named as Butyrophilin subfamily 3 member A1 or BTF5, is a 513 amino acid protein ,which contains one B30.2/SPRY domain and two Ig-like V-type (immunoglobulin-like) domains. BTN3A1 localizes in the cell membrane and belongs to the immunoglobulin superfamily. BTN/MOG family. BTN3A1 is detected on T-cells, natural killer cells, dendritic cells and macrophages. It is ubiquitously highly expressed in heart, pancreas and lung and moderately expressed in placenta, liver and muscle. BTN3A1 plays a role in T-cell activation and in the adaptive immune response. It also regulates the proliferation of activated T-cells and the release of cytokines and IFNG by activated T-cells. It exists as four isoforms. We detected a 48 kda isoform by western blot. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18414 Product name: Recombinant human BTN3A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 267-336 aa of BC121800 Sequence: GYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKAL Predict reactive species Full Name: butyrophilin, subfamily 3, member A1 Calculated Molecular Weight: 513 aa, 58 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC121800 Gene Symbol: BTN3A1 Gene ID (NCBI): 11119 RRID: AB_2879969 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00481 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924