Proteintech, 25225-1-AP, Galectin 10 Polyclonal antibody

Size: 20ul / 150ul Galectin 10 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA 25225-1-AP targets Galectin 10 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells Positive IHC detected in: human lung tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Galectin-10 (Gal-10), also called Charcot-Leyden Crystal (CLC) protein, is a member of the galectin superfamily of galactoside-binding lectins and is most prominently expressed in human eosinophils, where it forms the classic hexagonal bipyramidal Charcot-Leyden crystals that are considered hallmarks of eosinophilic inflammatory reactions. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18569 Product name: Recombinant human CLC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC119711 Sequence: MSLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR Predict reactive species Full Name: Charcot-Leyden crystal protein Calculated Molecular Weight: 142 aa, 16 kDa Observed Molecular Weight: 13-16 kDa GenBank Accession Number: BC119711 Gene Symbol: Galectin 10 Gene ID (NCBI): 1178 RRID: AB_2879973 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q05315 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.