Proteintech, 25231-1-AP, IRGM Polyclonal antibody

Size: 20ul / 150ul The IRGM (25231-1-AP) by Proteintech is a Polyclonal antibody targeting IRGM in WB, ELISA applications with reactivity to human samples 25231-1-AP targets IRGM in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: RAW 264.7 cells, J774A.1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18631 Product name: Recombinant human IRGM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-181 aa of BC128168 Sequence: MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY Predict reactive species Full Name: immunity-related GTPase family, M Calculated Molecular Weight: 181 aa, 20 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC128168 Gene Symbol: IRGM Gene ID (NCBI): 345611 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A1A4Y4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.