Proteintech, 25250-1-AP, CHL1 Polyclonal antibody

Size: 20ul / 150ul The CHL1 (25250-1-AP) by Proteintech is a Polyclonal antibody targeting CHL1 in WB, ELISA applications with reactivity to human, mouse, monkey samples 25250-1-AP targets CHL1 in WB, ELISA applications and shows reactivity with human, mouse, monkey samples. Tested Applications Positive WB detected in: mouse brain tissue, COS-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, monkey Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19263 Product name: Recombinant human CHL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 737-1066 aa of BC104918 Sequence: SMEQNGPGLEYRVTWKPQGAPVEWEEETVTNHTLRVMTPAVYAPYDVKVQAINQLGSGPDPQSVTLYSGEDYPDTAPVIHGVDVINSTLVKVTWSTVPKDRVHGRLKGYQINWWKTKSLLDGRTHPKEVNILRFSGQRNSGMVPSLDAFSEFHLTVLAYNSKGAGPESEPYIFQTPEGVPEQPTFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEIGELNDINITTPSKPSWHLSNLNATTKYKFYLRACTSQGCGKPITEESSTLGEGSKGIGKISGVNLTQKTHPVEVFEPGAEHIVRLMTKNWGDNDSIFQDVIETR Predict reactive species Full Name: cell adhesion molecule with homology to L1CAM (close homolog of L1) Calculated Molecular Weight: 1208 aa, 135 kDa Observed Molecular Weight: 135 kDa GenBank Accession Number: BC104918 Gene Symbol: CHL1 Gene ID (NCBI): 10752 RRID: AB_2879988 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00533 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.