Proteintech, 25252-1-AP, GUCY2F Polyclonal antibody

Size: 20ul / 150ul The GUCY2F (25252-1-AP) by Proteintech is a Polyclonal antibody targeting GUCY2F in WB, IHC, ELISA applications with reactivity to human, mouse samples 25252-1-AP targets GUCY2F in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GUCY2F(Guanylate cyclase 2F, retinal) is also named as GUC2F, RETGC2 and belongs to the adenylyl cyclase class-4/guanylyl cyclase family. GUCY2F may play a specific functional role in the rods and/or cones of photoreceptors. It may be the enzyme involved in the resynthesis of cGMP required for recovery of the dark state after phototransduction. By in situ hybridization, mRNA encoding GUCY2F is found only in the outer nuclear layer and inner segments of photoreceptor cells. By using synthetic peptide antiserum specific for each RetGC subtype, RetGC-2(GUCY2F) can be distinguished from RetGC-1 as a slightly smaller protein in immunoblots of bovine rod outer segments.(PMID:7777544). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19266 Product name: Recombinant human GUCY2F protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 71-398 aa of BC156674 Sequence: LPEVAARLAIERINRDPSFDLSYSFEYVILNEDCQTSRALSSFISHHQMASGFIGPTNPGYCEAASLLGNSWDKGIFSWACVNYELDNKISYPTFSRTLPSPIRVLVTVMKYFQWAHAGVISSDEDIWVHTANRVASALRSHGLPVGVVLTTGQDSQSMRKALQRIHQADRIRIIIMCMHSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYRVLRNNPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDS Predict reactive species Full Name: guanylate cyclase 2F, retinal Calculated Molecular Weight: 1108 aa, 125 kDa Observed Molecular Weight: 125 kDa GenBank Accession Number: BC156674 Gene Symbol: GUCY2F Gene ID (NCBI): 2986 RRID: AB_2879989 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51841 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.