Proteintech, 25257-1-AP, MYBPC2 Polyclonal antibody

Size: 20ul / 150ul The MYBPC2 (25257-1-AP) by Proteintech is a Polyclonal antibody targeting MYBPC2 in WB, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 25257-1-AP targets MYBPC2 in WB, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IP detected in: mouse skeletal muscle tissue Positive IF-P detected in: mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information MYBPC2, also known as MYBPCF, fMyBP-C, is a member of the myosin-binding protein C (MYBPC)family. MYBPC is a myosin-associated protein found in the cross-bridge-bearing zone, or C region, of A bands in striated muscle. MYBPC has three paralogs encoded by unique genes, including slow skeletal (MYBPC1), fast skeletal (MYBPC2), and cardiac (MYBPC3). Slow skeletal MyBP-C (sMyBP-C), fast skeletal MyBP-C (fMyBP-C), and cardiac MyBP-C (cMyBP-C) proteins are highly conserved with over 90% homology. They play unique muscle-specific structural and regulatory roles in actomyosin interactions and contractility in striated muscles, including both cardiac and skeletal muscles (PMID: 35832193, 23936073). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19424 Product name: Recombinant human MYBPC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-227 aa of BC136389 Sequence: MPEAKPAAKKAPKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSEKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYE Predict reactive species Full Name: myosin binding protein C, fast type Calculated Molecular Weight: 1141 aa, 128 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC136389 Gene Symbol: MYBPC2 Gene ID (NCBI): 4606 RRID: AB_3669466 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14324 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.