Proteintech, 25285-1-AP, CCL25/TECK Polyclonal antibody

Size: 20ul / 150ul The CCL25/TECK (25285-1-AP) by Proteintech is a Polyclonal antibody targeting CCL25/TECK in IHC, ELISA applications with reactivity to human samples 25285-1-AP targets CCL25/TECK in IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human thymus tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CCL25, also known as Thymus-Expressed Chemokine (TECK), is a small chemokine belonging to the CC subfamily, first isolated from mouse thymus in 1997. Its official full name is "C-C motif chemokine ligand 25". CCL25 is mainly expressed in the thymus and small-intestinal epithelium, and to a lesser extent by vascular endothelial cells and other parenchymal tissues. It selectively attracts dendritic cells, thymocytes, and activated macrophages via binding to its high-affinity G-protein-coupled receptor CCR9, while showing no chemotactic activity on peripheral blood lymphocytes or neutrophils. Through this CCR9-CCL25 axis it orchestrates T-cell development in the thymus and guides CCR9⁺ lymphocytes-especially IgA-producing plasma cells and intra-epithelial lymphocytes-to the small intestine, thus participating in mucosal immunity and gut homeostasis. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17994 Product name: Recombinant human CCL25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-150 aa of BC130561 Sequence: QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL Predict reactive species Full Name: chemokine (C-C motif) ligand 25 Calculated Molecular Weight: 150 aa, 17 kDa GenBank Accession Number: BC130561 Gene Symbol: CCL25/TECK Gene ID (NCBI): 6370 RRID: AB_2880008 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15444 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.