Iright
BRAND / VENDOR: Proteintech

Proteintech, 25290-1-AP, PDE3B Polyclonal antibody

CATALOG NUMBER: 25290-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PDE3B (25290-1-AP) by Proteintech is a Polyclonal antibody targeting PDE3B in WB, IP, ELISA applications with reactivity to human samples 25290-1-AP targets PDE3B in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information PDE3B is a cyclic nucleotide phosphodiesterase with dual specificity for cAMP and cGMP. It plays crucial roles in regulating physiological processes such as angiogenesis and cardiac contractility. PDE3B can be activated by insulin and is involved in the antilipolytic actions of insulin. Additionally, PDE3B forms macromolecular complexes that are important for its activation and interaction with other proteins (PMID: 22001403, PMID: 26031333). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18064 Product name: Recombinant human PDE3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 321-670 aa of BC136565 Sequence: CISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEARNMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLDLILVEEYDSL Predict reactive species Full Name: phosphodiesterase 3B, cGMP-inhibited Calculated Molecular Weight: 1112 aa, 124 kDa Observed Molecular Weight: 124 kDa GenBank Accession Number: BC136565 Gene Symbol: PDE3B Gene ID (NCBI): 5140 RRID: AB_2880010 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13370 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924