Proteintech, 25306-1-AP, F2RL3 Polyclonal antibody

Size: 20ul / 150ul The F2RL3 (25306-1-AP) by Proteintech is a Polyclonal antibody targeting F2RL3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25306-1-AP targets F2RL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse pancreas tissue Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Coagulation factor II receptor-like 3 (F2RL3) encodes a member of the protease-activated receptor subfamily, also known as protease-activated receptor 4 (PAR4), which takes partin platelet activation, intimal hyperplasia and inflammation (PMID:34284820). An absence of PAR4 in mouse models results in impaired hemostasis and a protection against pulmonary embolism, and a small number of missense coding variants in F2RL3 that alter platelet aggregation and function have been described(PMID:35012325). The calculated molecular weight and observed molecular weight of F2RL3 are both 41 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20801 Product name: Recombinant human F2RL3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 305-385 aa of BC074782 Sequence: LHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ Predict reactive species Full Name: coagulation factor II (thrombin) receptor-like 3 Calculated Molecular Weight: 385 aa, 41 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC074782 Gene Symbol: F2RL3 Gene ID (NCBI): 9002 RRID: AB_2880022 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96RI0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.