Proteintech, 25308-1-AP, NTAQ1/WDYHV1 Polyclonal antibody

Size: 20ul / 150ul The NTAQ1/WDYHV1 (25308-1-AP) by Proteintech is a Polyclonal antibody targeting NTAQ1/WDYHV1 in WB, ELISA applications with reactivity to human, mouse, rat samples 25308-1-AP targets NTAQ1/WDYHV1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, U-251 cells, U2OS cells, mouse pancreas tissue, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14713 Product name: Recombinant human WDYHV1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC008781 Sequence: MEGNGPAAVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNC Predict reactive species Full Name: WDYHV motif containing 1 Calculated Molecular Weight: 205 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC008781 Gene Symbol: WDYHV1 Gene ID (NCBI): 55093 RRID: AB_3669469 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96HA8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.