Proteintech, 25322-1-AP, GNAT3 Polyclonal antibody

Size: 20ul / 150ul The GNAT3 (25322-1-AP) by Proteintech is a Polyclonal antibody targeting GNAT3 in IHC, ELISA applications with reactivity to human, mouse samples 25322-1-AP targets GNAT3 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GNAT3 (Guanine nucleotide-binding protein G(t) subunit alpha-3), also known as α-gustducin, is a protein that plays a key role in taste signaling. It is part of the G-protein family and is mainly expressed in Type II taste cells in the taste buds of the tongue. GNAT3 is involved in detecting sweet, bitter, and umami tastes by activating a signaling cascade that includes PLCβ2, TRPM5, and other downstream effectors. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18121 Product name: Recombinant human GNAT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 83-137 aa of BC147016 Sequence: AIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMTPQLAEVIKRLWRDPGIQ Predict reactive species Full Name: guanine nucleotide binding protein, alpha transducing 3 Calculated Molecular Weight: 354 aa, 40 kDa GenBank Accession Number: BC147016 Gene Symbol: GNAT3 Gene ID (NCBI): 346562 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A8MTJ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.