Iright
BRAND / VENDOR: Proteintech

Proteintech, 25323-1-AP, CD32A/C Polyclonal antibody

CATALOG NUMBER: 25323-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD32A/C (25323-1-AP) by Proteintech is a Polyclonal antibody targeting CD32A/C in WB, ELISA applications with reactivity to human samples 25323-1-AP targets CD32A/C in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, U-937 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information IgG Fc receptors (FcγRs) play important roles in immune responses. The low-affinity IgG Fc receptor, FcγRII (CD32), consists of a family of primarily cell membrane receptor proteins: CD32A, CD32B, and CD32C. They are encoded by the mRNA splice variants of three highly related genes: FCGR2A, FCGR2B, and FCGR2C (PMID: 30941127). CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. This antibody raised against 254-323 aa of human CD32C (FCGR2C) can recognize both CD32A and CD32C forms. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18123 Product name: Recombinant human FCGR2C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 254-323 aa of BC137397 Sequence: ANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN Predict reactive species Full Name: Fc fragment of IgG, low affinity IIc, receptor for (CD32) Calculated Molecular Weight: 323 aa, 36 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC137397 Gene Symbol: CD32A/C Gene ID (NCBI): 9103 RRID: AB_3085785 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31995 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924