Iright
BRAND / VENDOR: Proteintech

Proteintech, 25357-1-AP, PPP1R16B Polyclonal antibody

CATALOG NUMBER: 25357-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPP1R16B (25357-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R16B in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 25357-1-AP targets PPP1R16B in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information PPP1R16B (Protein Phosphatase 1 Regulatory Subunit 16B), also known as TIMAP or ANKRD4, is a membrane-associated protein that acts as a regulator of protein phosphatase 1 (PP1). It contains five ankyrin repeats, a PP1-interacting domain, and a C-terminal CAAX box domain. The synthesis of PPP1R16B is inhibited by transforming growth factor-beta-1 (TGF-β-1), and it is predominantly expressed in endothelial cells. It has 2 isoforms with the molecular mass of 59 and 64 kDa. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19269 Product name: Recombinant human PPP1R16B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 351-565 aa of BC131801 Sequence: LSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKIPRGELDMPVENGLRAPVSAYQYALANGDVWKVHEVPDYSMAYGNPGVADATPPWSSYKEQSPQTLLELKRQRAAAKLLSHPFLSTHLGSSMARTGESSSEGKAPLIGGRTSPYSSNGTSVYYTVTSGDPPLLKFKAPIEEMEEKVHGCCR Predict reactive species Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 16B Calculated Molecular Weight: 567 aa, 64 kDa Observed Molecular Weight: 60 kDa, 70 kDa GenBank Accession Number: BC131801 Gene Symbol: PPP1R16B Gene ID (NCBI): 26051 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96T49 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924