Proteintech, 25362-1-AP, C3orf43 Polyclonal antibody

Size: 20ul / 150ul The C3orf43 (25362-1-AP) by Proteintech is a Polyclonal antibody targeting C3orf43 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 25362-1-AP targets C3orf43 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, human plasma tissue Positive IF/ICC detected in: A431 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21670 Product name: Recombinant human C3orf43 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-214 aa of BC118636 Sequence: MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQAAQDEMWTAVRALQLTSMELNILYSYVIEVLICLHTRVLEKLPDLVRGLPTLASVLRRKVKNKRVRVVWESILEECGLQEGDITALCTFFIARGNKAEHYTAKVRQMYIRDVTFLITNMVKNQALQDSLLRAVQVIEKGKAVRTPEKQKSSLEELIPSVKN Predict reactive species Full Name: chromosome 3 open reading frame 43 Calculated Molecular Weight: 214 aa, 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC118636 Gene Symbol: C3orf43 Gene ID (NCBI): 255798 RRID: AB_2880044 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q147U7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.