Iright
BRAND / VENDOR: Proteintech

Proteintech, 25383-1-AP, MTF1 Polyclonal antibody

CATALOG NUMBER: 25383-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MTF1 (25383-1-AP) by Proteintech is a Polyclonal antibody targeting MTF1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25383-1-AP targets MTF1 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, Jurkat cells, mouse brain tissue, mouse heart tissue, mouse skeletal muscle tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Metal regulatory transcription factor 1 (MTF1), contains six C2H2-type zinc finger and localizes in the nucleus. MTF1 is a 753 amino acid protein and calculated molecular weight is 81 kDa. We always dectected a 65-70 protein by western blot. MTF1 binds to the metal responsive element and activates the metallothionein I promoter. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, fish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21848 Product name: Recombinant human MTF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 404-753 aa of BC014454 Sequence: VSDVPPSTGNSASLSLPLVLQPGLSEPPQPLLPASAPSAPPPAPSLGPGSQQAAFGNPPALLQPPEVPVPHSTQFAANHQEFLPHPQAPQPIVPGLSVVAGASASAAAVASAVAAPAPPQSTTEPLPAMVQTLPLGANSVLTNNPTITITPTPNTAILQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPGSSVQQIGLSVPVIIIKQEEACQCQCACRDSAKERASSRRKGCSSPPPPEPSPQAPDGPSLQLPAQTFSSAPVPGSSSSTLPSSCEQSRQAETPSDPQTETLSAMDVSEFLSLQSLDTPSNLIPIEALLQGEEEMGLTSSFSK Predict reactive species Full Name: metal-regulatory transcription factor 1 Calculated Molecular Weight: 753 aa, 81 kDa Observed Molecular Weight: 65-70 kDa, 100 kDa GenBank Accession Number: BC014454 Gene Symbol: MTF1 Gene ID (NCBI): 4520 RRID: AB_2880053 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14872 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924