Iright
BRAND / VENDOR: Proteintech

Proteintech, 25395-1-AP, FAM20C Polyclonal antibody

CATALOG NUMBER: 25395-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM20C (25395-1-AP) by Proteintech is a Polyclonal antibody targeting FAM20C in IHC, ELISA applications with reactivity to human, mouse, rat samples 25395-1-AP targets FAM20C in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human kidney tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FAM20C, also named as Golgi-enriched fraction casein kinase or Dentin matrix protein 4, is a 584 amino acid protein, which belongs to the FAM20 family. FAM20C is widely expressed. FAM20C as a Calcium-binding kinase that phosphorylates the caseins and several secreted proteins implicated in biomineralization, including the secretory calcium binding phosphoproteins (SCPP). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22061 Product name: Recombinant human FAM20C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 121-269 aa of BC040074 Sequence: AHRPLLRDPGPRRSESPPGPGGDASLLARLFEHPLYRVAVPPLTEEDVLFNVNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDSYPNWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIMTFQNYGQAL Predict reactive species Full Name: family with sequence similarity 20, member C Calculated Molecular Weight: 584 aa, 66 kDa GenBank Accession Number: BC040074 Gene Symbol: FAM20C Gene ID (NCBI): 56975 RRID: AB_2880058 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IXL6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924