Iright
BRAND / VENDOR: Proteintech

Proteintech, 25402-1-AP, SLC25A22 Polyclonal antibody

CATALOG NUMBER: 25402-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC25A22 (25402-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A22 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, monkey samples 25402-1-AP targets SLC25A22 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: mouse brain tissue, Caco-2 cells, HT-29 cells, rat brain tissue, NCI-H1299 cells Positive IHC detected in: mouse brain tissue, human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: COS-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SLC25A22 encodes a mitochondrial glutamate/H+ symporter with highly expression in brain, especially in astrocytes, where it controls glutamate uptake. The mutations of SLC25A22 are associated with the early/infantile epileptic encephalopathies. It has been shown that SLC25A22 plays a key role in promoting proliferation and migration in cancer, such as human colorectal cancer (CRC) and Gallbladder cancer (GBC). And there is a result that the expression of SLC25A22 in GBC was significantly higher than that in adjacent tissues. 25402-1-AP antibody is specific to SLC25A22.(PMID: 30814911, 25033742, 24596948) Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19958 Product name: Recombinant human SLC25A22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 128-188 aa of BC023545 Sequence: KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier: glutamate), member 22 Calculated Molecular Weight: 323 aa, 34 kDa Observed Molecular Weight: 30-34 kDa GenBank Accession Number: BC023545 Gene Symbol: SLC25A22 Gene ID (NCBI): 79751 RRID: AB_2880060 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H936 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924