Product Description
Size: 20ul / 150ul
The ZNF740 (25411-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF740 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples
25411-1-AP targets ZNF740 in WB, IHC, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse brain tissue, mouse testis tissue, PC-3 cells, mouse liver tissue
Positive IP detected in: mouse brain tissue
Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22295 Product name: Recombinant human ZNF740 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC053557 Sequence: MAQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSDKSRSRKDDDSLSEASHSKKTVKKVVVVEQN Predict reactive species
Full Name: zinc finger protein 740
Calculated Molecular Weight: 193 aa, 22 kDa
Observed Molecular Weight: 22-30 kDa
GenBank Accession Number: BC053557
Gene Symbol: ZNF740
Gene ID (NCBI): 283337
RRID: AB_2880065
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8NDX6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924