Proteintech, 25424-1-AP, PLEKHF2 Polyclonal antibody

Size: 20ul / 150ul The PLEKHF2 (25424-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHF2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 25424-1-AP targets PLEKHF2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: rat brown adipose tissue, mouse brown adipose tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brown adipose tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Phafin2 is a lysosomal protein consisting of 249 amino acids with a unique structure containing both an N-terminal PH (pleckstrin homology) domain and C terminal FYVE (Fab 1, YOTB, Vac 1, and EEA1) domain. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22285 Product name: Recombinant human PLEKHF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 186-249 aa of BC011806 Sequence: CSEKRFLLPSQSSKPVRICDFCYDLLSAGDMATCQPARSDSYSQSLKSPLNDMSDDDDDDDSSD Predict reactive species Full Name: pleckstrin homology domain containing, family F (with FYVE domain) member 2 Calculated Molecular Weight: 249 aa, 28 kDa Observed Molecular Weight: 22-27 kDa GenBank Accession Number: BC011806 Gene Symbol: PLEKHF2 Gene ID (NCBI): 79666 RRID: AB_3669474 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H8W4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.