Proteintech, 25457-1-AP, VSTM2L Polyclonal antibody

Size: 20ul / 150ul The VSTM2L (25457-1-AP) by Proteintech is a Polyclonal antibody targeting VSTM2L in IHC, ELISA applications with reactivity to human samples 25457-1-AP targets VSTM2L in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22292 Product name: Recombinant human VSTM2L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-204 aa of BC033818 Sequence: RSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGSYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL Predict reactive species Full Name: V-set and transmembrane domain containing 2 like Calculated Molecular Weight: 204 aa, 22 kDa GenBank Accession Number: BC033818 Gene Symbol: VSTM2L Gene ID (NCBI): 128434 RRID: AB_2880089 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96N03 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.