Proteintech, 25467-1-AP, SAAL1 Polyclonal antibody

Size: 20ul / 150ul The SAAL1 (25467-1-AP) by Proteintech is a Polyclonal antibody targeting SAAL1 in WB, IF/ICC, ELISA applications with reactivity to human samples 25467-1-AP targets SAAL1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22186 Product name: Recombinant human SAAL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 181-475 aa of BC012010 Sequence: HPAIYDSICFIMSSSTNVDLLVKVGEVVDKLFDLDEKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWLDVYMHILQLLTTVDDGIQAIVHCPDTGKDIWNLLFDLVCHEFCQSDDPPIILQEQKTVLASVFSVLSAIYASQTEQEYLKIEKVDLPLIDSLIRVLQNMEQCQKKPENSAESNTEETKRTDLTQDDFHLKILKDILCEFLSNIFQALTKETVAQGVKEGQLSKQKCSSAFQNLLPFYSPVVEDFIKILREVDKALADDLEKNFPSLKVQT Predict reactive species Full Name: serum amyloid A-like 1 Calculated Molecular Weight: 475 aa, 54 kDa Observed Molecular Weight: 54-55 kDa GenBank Accession Number: BC012010 Gene Symbol: SAAL1 Gene ID (NCBI): 113174 RRID: AB_2880094 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96ER3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.