Proteintech, 25487-1-AP, GRAMD1A Polyclonal antibody

Size: 20ul / 150ul The GRAMD1A (25487-1-AP) by Proteintech is a Polyclonal antibody targeting GRAMD1A in WB, IHC, ELISA applications with reactivity to human samples 25487-1-AP targets GRAMD1A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293T cells, HeLa cells, SH-SY5Y cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Protein Aster-A (GRAMD1A) is a cholesterol transporter, which contains unique domains for binding cholesterol and the plasma membrane (PM), thereby serving as a molecular bridge for the transfer of cholesterol from the PM to the endoplasmic reticulum (ER). It was reported that plays a role in autophagy regulation and is required for the biogenesis of the autophagosome (PMID:31222192). It can be detected as 80 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22221 Product name: Recombinant human GRAMD1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 234-465 aa of BC014077 Sequence: LQLNGLGTPKEVGDVIALSDITSSGAADRSQEPSPVGSRRGHVTPNLSRASSDADHGAEEDKEEQVDSQPDASSSQTVTPVAEPPSTEPTQPDGPTTLGPLDLLPSEELLTDTSNSSSSTGEEADLAALLPDLSGRLLINSVFHVGAERLQQMLFSDSPFLQGFLQQCKFTDVTLSPWSGDSKCHQRRVLTYTIPISNPLGPKSASVVETQTLFRRGPQAGGCVVDSEVLTQ Predict reactive species Full Name: GRAM domain containing 1A Calculated Molecular Weight: 724 aa, 81 kDa Observed Molecular Weight: 80-90 kDa GenBank Accession Number: BC014077 Gene Symbol: GRAMD1A Gene ID (NCBI): 57655 RRID: AB_2935462 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CP6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.