Proteintech, 25490-1-AP, MOSC1 Polyclonal antibody

Size: 20ul / 150ul The MOSC1 (25490-1-AP) by Proteintech is a Polyclonal antibody targeting MOSC1 in WB, ELISA applications with reactivity to human, mouse samples 25490-1-AP targets MOSC1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information MOSC1 also known as MTARC1 and MARC1. It has 3 isoforms and is mainly expressed in liver, breast and adipose tissue. It is a novel signal-anchored protein of the outer mitochondrial membrane and is active in the N- reductive enzyme system and was also found to contribute to the regulation of nitric oxide synthesis (PMID: 23086957). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21989 Product name: Recombinant human MOSC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-230 aa of BC010619 Sequence: LTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEAAAQWITSFLKSQPYRLVHFEPHKRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEK Predict reactive species Full Name: MOCO sulphurase C-terminal domain containing 1 Calculated Molecular Weight: 337 aa, 37 kDa Observed Molecular Weight: 35-42 kDa GenBank Accession Number: BC010619 Gene Symbol: MOSC1 Gene ID (NCBI): 64757 RRID: AB_3669480 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VT66 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.