Product Description
Size: 20ul / 150ul
The C18orf45 (25499-1-AP) by Proteintech is a Polyclonal antibody targeting C18orf45 in WB, ELISA applications with reactivity to human samples
25499-1-AP targets C18orf45 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A431 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag21686 Product name: Recombinant human C18orf45 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 67-127 aa of BC114561 Sequence: SHVLVWLPASVLFVGIIYAGSRALSRLAIPVFLTLHNVAEVIICGYQKCFQKEKTSPAKIC Predict reactive species
Full Name: chromosome 18 open reading frame 45
Calculated Molecular Weight: 296 aa, 33 kDa
Observed Molecular Weight: 35-40 kDa
GenBank Accession Number: BC114561
Gene Symbol: C18orf45
Gene ID (NCBI): 85019
RRID: AB_2880104
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q24JQ0
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924