Proteintech, 25503-1-AP, UCMA Polyclonal antibody

Size: 20ul / 150ul The UCMA (25503-1-AP) by Proteintech is a Polyclonal antibody targeting UCMA in WB, ELISA applications with reactivity to human, mouse samples 25503-1-AP targets UCMA in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information UCMA, also named as C10orf49, Ucma-C and GRP, is a 17 kDa small, highly charged, and secreted protein. It has been described as a novel secretory protein mainly expressed in cartilage and also as a novel vitamin-K-dependent protein. UCMA is involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21985 Product name: Recombinant human UCMA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-139 aa of BC018068 Sequence: VSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT Predict reactive species Full Name: upper zone of growth plate and cartilage matrix associated Calculated Molecular Weight: 138 aa, 17 kDa Observed Molecular Weight: ~14 kDa GenBank Accession Number: BC018068 Gene Symbol: UCMA Gene ID (NCBI): 221044 RRID: AB_2880106 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVF2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.