Proteintech, 25526-1-AP, SLC35F2 Polyclonal antibody

Size: 20ul / 150ul The SLC35F2 (25526-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35F2 in WB, ELISA applications with reactivity to human, mouse samples 25526-1-AP targets SLC35F2 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SLC35F2, also named as Solute carrier family 35 member F2, is a 374 amino acid protein, which belongs to the SLC35F solute transporter family. SLC35F2 as a Multi-pass membrane protein is a putative solute transporter. SLC35F2 is highly homologous to the lung squamous cell cancer-related gene, LSCC3, which is highly expressed in lung squamous cell tumour tissues. However, the clinical implication of the SLC35F2 gene in tumour development and progression remains unclear. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20901 Product name: Recombinant human SLC35F2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-132 aa of BC039195 Sequence: MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLSLCICGTAITSQYLAERYKVNTPMLQSFINYCLLFLIYTVMLAFRSGSDNLLVILKRKWWKYILLGLADVEANYVIVRAYQYT Predict reactive species Full Name: solute carrier family 35, member F2 Calculated Molecular Weight: 374 aa, 41 kDa Observed Molecular Weight: 41-50 kDa GenBank Accession Number: BC039195 Gene Symbol: SLC35F2 Gene ID (NCBI): 54733 RRID: AB_2880119 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IXU6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.