Product Description
Size: 20ul / 150ul
The SLC35F2 (25526-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35F2 in WB, ELISA applications with reactivity to human, mouse samples
25526-1-AP targets SLC35F2 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: A549 cells, mouse brain tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Background Information
SLC35F2, also named as Solute carrier family 35 member F2, is a 374 amino acid protein, which belongs to the SLC35F solute transporter family. SLC35F2 as a Multi-pass membrane protein is a putative solute transporter. SLC35F2 is highly homologous to the lung squamous cell cancer-related gene, LSCC3, which is highly expressed in lung squamous cell tumour tissues. However, the clinical implication of the SLC35F2 gene in tumour development and progression remains unclear.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20901 Product name: Recombinant human SLC35F2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-132 aa of BC039195 Sequence: MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLSLCICGTAITSQYLAERYKVNTPMLQSFINYCLLFLIYTVMLAFRSGSDNLLVILKRKWWKYILLGLADVEANYVIVRAYQYT Predict reactive species
Full Name: solute carrier family 35, member F2
Calculated Molecular Weight: 374 aa, 41 kDa
Observed Molecular Weight: 41-50 kDa
GenBank Accession Number: BC039195
Gene Symbol: SLC35F2
Gene ID (NCBI): 54733
RRID: AB_2880119
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8IXU6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924