Product Description
Size: 20ul / 150ul
The TMEM115 (25536-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM115 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
25536-1-AP targets TMEM115 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: U2OS cells, mouse skeletal muscle tissue, rat skeletal muscle tissue
Positive IHC detected in: human ovary cancer tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
TMEM115 also known as PL6, located on chromosome 3p21.3, was originally thought to function as a tumor suppressor. TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22258 Product name: Recombinant human TMEM115 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 233-351 aa of BC017367 Sequence: QPVVGLLANLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPTL Predict reactive species
Full Name: transmembrane protein 115
Calculated Molecular Weight: 351 aa, 38 kDa
Observed Molecular Weight: 35-38 kDa
GenBank Accession Number: BC017367
Gene Symbol: TMEM115
Gene ID (NCBI): 11070
RRID: AB_3669482
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q12893
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924