Iright
BRAND / VENDOR: Proteintech

Proteintech, 25548-1-AP, ATRAID Polyclonal antibody

CATALOG NUMBER: 25548-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATRAID (25548-1-AP) by Proteintech is a Polyclonal antibody targeting ATRAID in WB, ELISA applications with reactivity to human, mouse samples 25548-1-AP targets ATRAID in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, HEK-293 cells, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information ATRAID, also named as APR3, p18, C2orf28, promotes osteoblast cell differentiation and terminal mineralization. It plays a role in inducing the cell cycle arrest via inhibiting CCND1 expression in all-trans-retinoic acid (ATRA) signal pathway. This antibody recognizes all the three isoforms (20-24 kDa, 16-19 kDa and 28-30 kDa). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22168 Product name: Recombinant human C2orf28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC035850 Sequence: MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSF Predict reactive species Full Name: chromosome 2 open reading frame 28 Calculated Molecular Weight: 229 aa, 25 kDa Observed Molecular Weight: 28-35 kDa GenBank Accession Number: BC035850 Gene Symbol: ATRAID Gene ID (NCBI): 51374 RRID: AB_2880128 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UW56 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924