Iright
BRAND / VENDOR: Proteintech

Proteintech, 25553-1-AP, METTL18 Polyclonal antibody

CATALOG NUMBER: 25553-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The METTL18 (25553-1-AP) by Proteintech is a Polyclonal antibody targeting METTL18 in WB, IF/ICC, ELISA applications with reactivity to human samples 25553-1-AP targets METTL18 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, PC-3 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information METTL18 belongs to a family of protein lysine methyltransferases that methylate nonhistone proteins. Methyltransferases catalyze the transfer of a methyl group from a donor, generally S-adenosyl-L-methionine, to acceptor molecules, including proteins, DNA, RNA, lipids, and small metabolites. METTL18 is involved in peptidyl-lysine monomethylation. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22148 Product name: Recombinant human C1orf156 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-372 aa of BC008679 Sequence: MTFQFNFTIEDHLENELTPIRDGALTLDSSKELSVSESQKGEERDRKCSAEQFDLPQDHLWEHKSMENAAPSQDTDSPLSAASSSRNLEPHGKQPSLRAAKEHAMPKDLKKMLENKVIETLPGFQHVKLSVVKTILLKENFPGENIVSKSFSSHSDLITGVYEGGLKIWECTFDLLAYFTKAKVKFAGKKVLDLGCGSGLLGITAFKGGSKEIHFQDYNSMVIDEVTLPNVVANSTLEDEENDVNEPDVKRCRKPKVTQLYKCRFFSGEWSEFCKLVLSSEKLFVKYDLILTSETIYNPDYYSNLHQTFLRLLSKNGRVLLASKAHYFGVGGGVHLFQKFVEERDVFKTRILKIIDEGLKRFIIEITFKFPG Predict reactive species Full Name: chromosome 1 open reading frame 156 Calculated Molecular Weight: 372 aa, 42 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC008679 Gene Symbol: METTL18 Gene ID (NCBI): 92342 RRID: AB_2880129 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95568 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924