Proteintech, 25565-1-AP, EPHX4 Polyclonal antibody

Size: 20ul / 150ul The EPHX4 (25565-1-AP) by Proteintech is a Polyclonal antibody targeting EPHX4 in WB, ELISA applications with reactivity to human samples 25565-1-AP targets EPHX4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information EPHX4 (Epoxide Hydrolase 4) is a protein coding gene and localized almost exclusively on the surface of lipid droplets(PMID:25523620). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22238 Product name: Recombinant human EPHX4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 175-264 aa of BC041475 Sequence: AWLIAICYPEMVMKLIVINFPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAY Predict reactive species Full Name: epoxide hydrolase 4 Calculated Molecular Weight: 362 aa, 42 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC041475 Gene Symbol: EPHX4 Gene ID (NCBI): 253152 RRID: AB_3085805 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IUS5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.