Iright
BRAND / VENDOR: Proteintech

Proteintech, 25568-1-AP, DYDC2 Polyclonal antibody

CATALOG NUMBER: 25568-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DYDC2 (25568-1-AP) by Proteintech is a Polyclonal antibody targeting DYDC2 in WB, ELISA applications with reactivity to human, pig samples 25568-1-AP targets DYDC2 in WB, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig oviduct tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22250 Product name: Recombinant human DYDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-177 aa of BC007374 Sequence: METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF Predict reactive species Full Name: DPY30 domain containing 2 Calculated Molecular Weight: 177 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC007374 Gene Symbol: DYDC2 Gene ID (NCBI): 84332 RRID: AB_3669486 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96IM9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924