Iright
BRAND / VENDOR: Proteintech

Proteintech, 25573-1-AP, ZNF689 Polyclonal antibody

CATALOG NUMBER: 25573-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF689 (25573-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF689 in WB, ELISA applications with reactivity to human, mouse, rat samples 25573-1-AP targets ZNF689 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse testis tissue, human testis tissue, mouse tests tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information ZNF689, a C2H2-type of Krüppel-associated box (KRAB)-zinc finger protein, is a putative transcription regulating factor. ZNF689 knockdown induced expression of the pro-apoptotic factors of the Bcl-2 family, Bax, Bcl-2 antagonist/killer 1 and Bid, resulting in tumor cell apoptosis (PMID: 21624362). ZNF689 was identified to be involved in suppressing the apoptosis of HCC cells via downregulation of the expression of pro-apoptotic factors (PMID: 38168642). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22252 Product name: Recombinant human ZNF689 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 77-173 aa of BC014000 Sequence: LISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVFPPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHQALESHKCAQNL Predict reactive species Full Name: zinc finger protein 689 Calculated Molecular Weight: 500 aa, 57 kDa Observed Molecular Weight: 50-57 kDa GenBank Accession Number: BC014000 Gene Symbol: ZNF689 Gene ID (NCBI): 115509 RRID: AB_2880134 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CS4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924