Product Description
Size: 20ul / 150ul
The ZNF549 (25592-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF549 in WB, IF/ICC, ELISA applications with reactivity to human samples
25592-1-AP targets ZNF549 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: SH-SY5Y cells, A549 cells, HeLa cells, SMMC-7721 cells
Positive IF/ICC detected in: A549 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
Background Information
ZNF549 (zinc finger protein 549), belonging to the kruppel C2H2-type zinc-finger protein family, is a 640 amino acid nuclear protein that exists as 2 alternatively spliced isoforms and may be involved in transcriptional regulation in cancer disease. Overexpression of ZNF549 inhibit the ability of COAD cell proliferation and migration (PMID: 33028966).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22371 Product name: Recombinant human ZNF549 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 109-236 aa of BC060863 Sequence: CILVMKDILYLSEHQGTLPWQKPYTSVASGKWFSFGSNLQQHQNQDSGEKHIRKEESSALLLNSCKIPLSDNLFPCKDVEKDFPTILGLLQHQTTHSRQEYAHRSRETFQQRRYKCEQVFNEKVHVTE Predict reactive species
Full Name: zinc finger protein 549
Calculated Molecular Weight: 640 aa, 74 kDa
Observed Molecular Weight: 74 kDa
GenBank Accession Number: BC060863
Gene Symbol: ZNF549
Gene ID (NCBI): 256051
RRID: AB_2880147
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q6P9A3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924